PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008223170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 167aa    MW: 18773.7 Da    PI: 6.5208
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008223170.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB165.28.7e-5223119197
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     ++eqd++lPianv+rimk++lP nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ngdd+ wal+ lGf+dy +pl+ +l++yre eg
  XP_008223170.1  23 MKEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDVSWALGALGFDDYTAPLRRFLHRYREKEG 117
                     589*******************************************************************************************9 PP

           NF-YB  96 ek 97 
                     e+
  XP_008223170.1 118 ER 119
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-5118143IPR009072Histone-fold
SuperFamilySSF471131.27E-3826145IPR009072Histone-fold
PfamPF008081.1E-272993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.4E-165775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.4E-167694No hitNo description
PRINTSPR006158.4E-1695113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MVDNNNNIGA SGAANHDEDG AMMKEQDQLL PIANVGRIMK QILPPNAKIS KEAKETMQEC  60
VSEFISFVTS EASEKCRKER RKTVNGDDVS WALGALGFDD YTAPLRRFLH RYREKEGERI  120
SSSANNNNEN NQDKANNNTE DQQQRILLNH PHIQRPNFNK GSSTTGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-4323114192Transcription factor HapC (Eurofung)
4g91_B3e-4323114192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008223170.11e-123PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822482e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM5XH853e-95M5XH85_PRUPE; Uncharacterized protein
STRINGSolyc06g009010.1.13e-62(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-56nuclear factor Y, subunit B5